WAP four-disulfide core domain protein 2 Human E. coli RD172369100 from BioVendor Laboratory Medicine, Inc. | Biocompare.com

Be the first to write a review!

Pricing Info Inquire

from
BioVendor Laboratory Medicine, Inc. for
WAP four-disulfide core domain protein 2 Human E. coli

Description

Total 104 AA. MW: 11.3 kDa (calculated). UniProtKB acc.no. Q14508 (Glu31-Phe124). N-terminal 10 extra AA. Protein identity confirmed by LC-MS/MS

Product Specs
ItemWAP four-disulfide core domain protein 2 Human E. coli
CompanyBioVendor Laboratory Medicine, Inc.
Price Pricing Info Inquire
Catalog NumberRD172369100
Quantity0.1 mg
ApplicationsWestern blotting, ELISA
FormatFiltered (0.4 µm) and lyophilized in 0.5 mg/mL in PBS buffer, pH 7.5, 4%mannitol, 1%sucrose
Molecule NameWAP four-disulfide core domain protein 2
Source/Expression SystemE. coli
Brand/TrademarkBioVendor
NCBI Full Gene NameWAP four-disulfide core domain 2
NCBI Gene AliasesEDDM4, HE4, WAP5, dJ461P17.6
Molecular Weight11.3 kDa
Domain/Region/TerminusN-terminal
SpeciesHuman

Sequence

MKHHHHHHASEKTGVCPEL-QADQNCTQECVSDSE-CADNLKCCSAGCAT-FCSLPNDKEGSCPQVNIN-FPQLGLCRDQCQVDSQCPGQMKCC-RNGCGKVSCVTPNF

Add to Compare List

BioVendor Laboratory Medicine, Inc.

BioVendor Laboratory Medicine, Inc.

Karasek 1/1767

Brno

Czech Republic

Phone: +1-828-670-7807 OR +1-800-404-7807
+1-828-670-7809

Company Profile

Website: http://www.biovendor.com

Be the First to Write a Review!